PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Dca17249.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Caryophyllaceae; Caryophylleae; Dianthus
Family GATA
Protein Properties Length: 363aa    MW: 40381.7 Da    PI: 6.4028
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Dca17249.1genomeDCAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA55.11e-17238272135
        GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35 
                 C +C t kTp+WR gp g+ktLCnaCG++y++ +l
  Dca17249.1 238 CLHCATDKTPQWRTGPMGPKTLCNACGVRYKSGRL 272
                 99*****************************9885 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0169926.6E-797329IPR016679Transcription factor, GATA, plant
PROSITE profilePS5011411.569232268IPR000679Zinc finger, GATA-type
SMARTSM004011.8E-18232282IPR000679Zinc finger, GATA-type
SuperFamilySSF577162.42E-15236296No hitNo description
Gene3DG3DSA:3.30.50.103.2E-14236270IPR013088Zinc finger, NHR/GATA-type
CDDcd002024.80E-14237284No hitNo description
PROSITE patternPS003440238263IPR000679Zinc finger, GATA-type
PfamPF003201.3E-15238272IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0007623Biological Processcircadian rhythm
GO:0009416Biological Processresponse to light stimulus
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 363 aa     Download sequence    Send to blast
MGSEFGCVPE RRVSDDKFIV EDLLDFSNDD DVVAHDDDLT AFDNETRHNS NNNSSDTSAV  60
VTPPDSGNSS FSGNVDVFPS AGDSQFSGEL CVPCDDLAEL EWFSNFMEES FSSEDLQKFN  120
MISGMSSAMK ARPDNTTLSE TRYYDLEPSR PDFIPNPTFG PEMPVPGKAR SKRSRAAPCN  180
WTSRLIVVSD GSPVPTQPGP EPKPVKSAPK KKSGSGAGTV SLARSSSGPG SDGEVRRCLH  240
CATDKTPQWR TGPMGPKTLC NACGVRYKSG RLVPEYRPAA SPTFVLTKHS NSHRKVMELR  300
RQKDMMRQQL HIHEQQHYHH QQQQQLIHHN NHHPSNNNMI FDPANSDDYL IHQHIGPDYR  360
QLI
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00530DAPTransfer from AT5G25830Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010668515.11e-134PREDICTED: GATA transcription factor 12-like
SwissprotP697811e-85GAT12_ARATH; GATA transcription factor 12
TrEMBLA0A0J8D1N61e-133A0A0J8D1N6_BETVU; Uncharacterized protein
STRINGPOPTR_0006s25410.11e-105(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G25830.16e-70GATA transcription factor 12